PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G33790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 325aa    MW: 34686 Da    PI: 10.1703
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G33790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.51.6e-14266308547
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN +Lk 
  OPUNC01G33790.1 266 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENVRLKR 308
                      79**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-14261309No hitNo description
SMARTSM003383.8E-11262324IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.369264309IPR004827Basic-leucine zipper domain
PfamPF001703.5E-12266308IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.63E-11266309No hitNo description
CDDcd147074.55E-24266311No hitNo description
PROSITE patternPS000360269284IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MASKTGGGGI GAGAAAQRGR MQSLGRQGSM YSLTLDEVQS HLGEPLHSMN LDELLRSVFP  60
DGLTIADGAG ATTSNQQHQP GSGLLRQGSI TMPPELSKKT VDEVWKGIQA APKRNAETGG  120
GGGRRWRERK PTLGEVTLED FLVKAGVVTE GSLKDLSDAG NVDPAGRGVT ATGTVDLASG  180
AHWIEQYKQQ IASSDAHHHG QQSVQGAYLP NRLVPQPLNV GPGAILESSY SDGQTSSGMI  240
GGMSDSQTPG RKRGMSGDVA DKLVERRQKR MIKNRESAAR SRARKQAYTN ELENKVSRLE  300
EENVRLKRQK ISRSLVCVLV ALLSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032470.0AP003247.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0425G02.
GenBankAP0035700.0AP003570.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0432B10.
GenBankAP0043310.0AP004331.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0085D07.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627754.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-73AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0E0JQ530.0A0A0E0JQ53_ORYPU; Uncharacterized protein
STRINGLOC_Os01g59760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-70ABA-responsive element binding protein 3